(€) EUR (Default)
  • (£) GBP
  • ($) USD
  • ($) AUD
  • ($) CAD
FOX04-DRI

FOX04-DRI

La proteina sintetica FOX04-DRI è una leggera modifica della proteina FOX04 originale. Il cambiamento estende l’emivita della proteina, consentendole di interrompere la normale funzione di FOX04. Di conseguenza, le cellule senescenti possono essere eliminate, la funzione degli organi migliorata e l'”età biologica” dei tessuti viene ridotta grazie a FOX04-DRI. Oltre alla segnalazione dell’insulina, FOX04-DRI influisce sul controllo del ciclo cellulare e sulle vie di segnalazione dello stress ossidativo. Inoltre, negli studi sugli animali è stato dimostrato che il peptide penetrante nelle cellule FOX04-DRI induce selettivamente l’apoptosi nelle cellule geriatriche, invertendo gli effetti del processo di invecchiamento.

235.99

Availability: In stock

Descrizione

Che cos’è esattamente FOX04-DRI:

Utilizzando Foxo4-dri, un peptide anti-invecchiamento, la comunicazione del gene p53 viene interrotta, provocando la morte delle cellule senescenti. La ricerca suggerisce che questo peptide, se ulteriormente studiato, potrebbe aiutare le persone a vivere più a lungo e ad avere una vita più sana riducendo il numero di cellule senescenti nei loro corpi.

Cellule senescenti: le cellule entrano in senescenza quando si invecchia, il che significa che non possono più distribuire o sostenere i tessuti a cui appartengono. Le cellule vicine diventano senescenti a causa dei segnali chimici tossici emessi da queste cellule che invecchiano. Quando queste cellule sono presenti, la funzione dei tessuti si deteriora, l’infiammazione aumenta e il rischio di cancro aumenta.

FOXO4 è stato trovato per ridurre lo sviluppo di queste cellule nocive, secondo gli studi. In sostanza, il peptide ormonale FOXO4 può trovare e distruggere le cellule senescenti se somministrato in quantità sufficienti.


Per cosa è noto FOX04-DRI?

Gli effetti antietà di FOXO4 DRI
Una vasta gamma di fattori influenza l’invecchiamento. Tuttavia, la senescenza cellulare, che viene stimolata quando i telomeri scadono, è la causa principale.

Quando le tue cellule si dividono, il DNA dei tuoi cromosomi viene replicato in ogni nuova cellula. Questo metodo, tuttavia, è pieno di difetti e di conseguenza finisce per rimuovere piccole quantità di DNA. Fortunatamente, i telomeri sono a disposizione per salvare la fine dei tuoi cromosomi dall’estinzione.

I telomeri sono essenzialmente un prodotto di scarto del genoma. Fino a 70 divisioni non sono rari per queste cose. Tuttavia, se si esauriscono, inviano segnali alle cellule, facendo sì che quelle sane prima diventino senescenti.

Studi clinici hanno dimostrato che FOX04 DRI è un trattamento efficace per fermare la diffusione di queste cellule una volta che sono iniziate.

Efficacia di FOXO4 nella promozione della crescita dei capelli
Secondo la ricerca, le condizioni genetiche di perdita di capelli come la calvizie femminile e la calvizie maschile possono essere aiutate dall’ormone FOXO4 DRI.

Attraverso la ricerca, gli scienziati hanno scoperto che FOXO4 aumenta lo spessore e la densità dei capelli riducendo la produzione di cellule senescenti.

I topi trattati con FOXo4 DRI per la caduta dei capelli avevano una pelliccia più spessa e meno calvizie, secondo la ricerca.

Malattie cardiache e FOXO4 DRI
L’attività del proteasoma del cuore diminuisce con l’età, il che aumenta il rischio di malattie cardiovascolari. Tuttavia, quando la cellula rileva proteine ossidate e altre proteine malfunzionanti, i proteasomi si attivano rimuovendole.

Secondo una ricerca sui topi, l’età e l’attività del proteasoma sono collegate, risultando in livelli più elevati di proteine danneggiate nel cuore.

Le proteine FOXO facilitano notevolmente l’autofagia e l’attività del proteasoma. L’aumento dei livelli di FOX04 aumenta l’attività del proteasoma, che riduce lo stress ossidativo e il danno tissutale.

Gli scienziati hanno concluso che FOXO4-DRI può aumentare le funzioni primarie del cuore e ridurre i cambiamenti nei ruoli cardiovascolari associati all’invecchiamento.

Effetti di FOXO4 sulla neurodegenerazione
Come risultato di questi studi, i ricercatori ritengono che le proteine FOXO4 DRI possano aiutare a curare e prevenire le malattie neurodegenerative. Inoltre, i ricercatori sperano che questo peptide rallenterà l’insorgenza di malattie neurodegenerative.

Il morbo di Alzheimer e altre forme di demenza sono ancora poco conosciute dai professionisti del settore medico. Di conseguenza, gli scienziati necessitano di ulteriori ricerche sui risultati di FOXO4 DRI per determinare i potenziali effetti del peptide sui pazienti e per garantire la sicurezza dei pazienti.

Sebbene gli effetti di FOXO4-DRI sulle condizioni legate all’invecchiamento siano promettenti, sono necessarie ulteriori ricerche prima che l’integratore possa essere approvato per il consumo umano.


Studi:

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5556182/


Effetti:

Si chiama FOXO4-DRI (forkhead box O4) e agisce inducendo selettivamente la morte cellulare nelle cellule vecchie per contrastare il processo di invecchiamento negli animali.

Il gene FOXO4 ha proprietà antietà e di soppressione del tumore in un unico pacchetto.

FOXO4-DRI è il senolitico più potente attualmente sotto indagine. Di conseguenza, le persone anziane che assumono questo integratore possono vivere più a lungo e sperimentare un minor declino cognitivo.


Effetti collaterali:

Studi di ricerca hanno dimostrato che gli effetti collaterali di FOXO4 sono minimi se somministrato per via orale o sottocutanea a basse dosi nei topi. Tuttavia, solo i ricercatori autorizzati possono attualmente acquistare FOXO4 per scopi didattici e scientifici.


Formula: C228H388N86O64

Massa molare: 5358.05

Sequenza: H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH

Quantità unitaria: 1 flaconcino

Aspetto: polvere bianca

Purezza del peptide:> 99%

Recensioni

Ancora non ci sono recensioni.

Recensisci per primo “FOX04-DRI”

Il tuo indirizzo email non sarà pubblicato.