(€) EUR (Default)
  • (£) GBP
  • ($) USD
  • ($) AUD
  • ($) CAD
Flaconcino GLP-1 da 2 mg

GLP-1

Il GLP-1, un peptide generato nell’intestino, aiuta a controllare i livelli di zucchero nel sangue nelle persone con diabete. Inoltre, secondo una nuova ricerca, il GLP-1 (peptide 1 simile al glucagone) può rafforzare la funzione polmonare, epatica e cardiaca mentre rallenta la progressione della malattia di Alzheimer. Questo peptide, identificato anche come Liraglutide, agisce rallentando la motilità intestinale e ritardando lo svuotamento gastrico per ridurre la fame.

31.99143.99

Availability: In stock

Svuota

Descrizione

Che cos’è esattamente il GLP-1:

Il GLP-1 è un peptide di 30-31 amminoacidi che si trova in natura.

I livelli di zucchero nel sangue vengono abbassati aumentando la secrezione di insulina come funzione primaria del GLP-1. Inoltre, la trascrizione del gene dell’insulina è protetta nelle cellule beta grazie al ruolo dell’ormone nel promuovere la trascrizione del gene dell’insulina. Il peptide GLP 1 può anche ridurre l’appetito e migliorare la salute del cuore, dei polmoni, delle ossa e dei reni e del resto del corpo.

Il pre-proglucagone, un polipeptide che produceva glucagone e altri ormoni, ha prodotto GLP1, un membro della famiglia degli ormoni incretinici. Questi ormoni sono indicati come “simili al glucagone” poiché condividono molte somiglianze con il glucagone, da cui derivano entrambi.

La principale fonte di peptide GLC-1 sono le cellule L, che sono piccole cellule intestinali. Anche il pancreas e il sistema nervoso centrale lo secernono, ma in quantità molto minori.


Per cosa è noto il GLP-1?

Il GLP-1, un peptide generato nell’intestino, aiuta a controllare i livelli di zucchero nel sangue nelle persone con diabete. Inoltre, secondo una nuova ricerca, il GLP-1 (peptide 1 simile al glucagone) può rafforzare la funzione polmonare, epatica e cardiaca mentre rallenta la progressione della malattia di Alzheimer. Questo peptide, identificato anche come Liraglutide, agisce rallentando la motilità intestinale e ritardando lo svuotamento gastrico per ridurre la fame.

I ricercatori stanno attualmente concentrando i loro sforzi sugli effetti del peptide GLP-1 sul trattamento e sulla prevenzione del diabete e sulla soppressione dell’appetito. I suoi potenziali effetti cardiovascolari, tuttavia, sono una fonte significativa di interesse per la ricerca. Un’altra area di ricerca per gli scienziati è se l’ormone GLP-1 può proteggere dalle malattie neurodegenerative come l’Alzheimer.


Studi:

https://clinicaltrials.gov/ct2/show/NCT03959865


Effetti:

Diabete
Gli effetti del Glp-1 sul diabete sono significativi. Un gruppo di ormoni metabolici abbassa i livelli di zucchero nel sangue a causa dell’effetto incretina, che è causato dal peptide simile al glucagone umano. Il GLP-1 è il più potente dei due ormoni quando è presente la glicemia alta, ma entrambi gli ormoni stimolano l’effetto.

I recettori del GLP-1 sono stati localizzati sulla superficie delle cellule beta del pancreas, suggerendo che il peptide incoraggia direttamente la mobilità dell’insulina dal pancreas. Secondo una nuova ricerca, l’assunzione di GLP-1 con farmaci sulfanilureici può causare una lieve ipoglicemia aumentando la secrezione di insulina.

La sintesi proteica, l’assorbimento degli aminoacidi da parte del muscolo e la disgregazione delle proteine aumentano quando aumenta la secrezione di insulina.

Perdere peso
Gli integratori dimagranti GLP-1 sono popolari perché aiutano le persone a perdere peso sopprimendo l’appetito e aumentando la perdita di grasso. Tuttavia, a causa della mancanza di studi clinici, non è ancora approvato dalla FDA e dovrebbe essere utilizzato solo nella ricerca medica. Anche così, il ruolo che GLP 1 gioca nella perdita di peso è intrigante.

I ricercatori hanno scoperto che l’iniezione di GLP-1 nel cervello dei topi riduce il loro appetito e quindi l’assunzione di cibo. Di conseguenza, può aumentare il senso di sazietà, aiutando le persone a evitare l’eccesso di cibo. Inoltre, la somministrazione del peptide GLP 1 due volte al giorno ha comportato una perdita di peso e un miglioramento della salute cardiovascolare.

Cervello
Negli studi è stato dimostrato che il peptide ormonale GLP-1 migliora l’apprendimento e protegge dalle malattie neurodegenerative come l’Alzheimer e altre condizioni simili. Secondo uno studio, il GLP-1 ha migliorato l’apprendimento spaziale e associativo nei topi per aiutare le persone con difficoltà di apprendimento causate da difetti genetici.

Cuore
La ricerca mostra che i recettori GLP 1 si trovano in tutto il cuore, ottimizzando la funzione cardiaca aumentando la frequenza cardiaca e diminuendo la pressione telediastolica ventricolare sinistra (LVEP). La riduzione dello stress telediastolico del ventricolo sinistro ha un impatto significativo sulla salute cardiovascolare perché è strettamente correlato al rimodellamento cardiaco, all’ipertrofia e all’arresto cardiaco.

La ricerca indica che il peptide di glucagone può aiutare a prevenire il danno cerebrale correlato all’arresto cardiaco. E lo fa aiutando le cellule muscolari più deboli a funzionare meglio e prevenendo la morte cellulare attraverso il peptide GLP1.


Effetti collaterali:

L’assunzione di GLP-1 comporta un possibile rischio di aumento di peso. Il pericolo più significativo qui è che una persona diventi obesa se non ha abbastanza produzione naturale di GLP-1 nei loro corpi.

Questo peptide è generalmente considerato privo di rischi e sicuro da usare. Inoltre, gli scienziati ritengono che i vantaggi della GLP 1 superino di gran lunga gli svantaggi minori.

Gli individui con una storia di cancro alla tiroide dovrebbero evitare di assumere il peptide GLP-1 perché studi su modelli di roditori hanno collegato questi ormoni ai tumori della tiroide.


Formula: C149H226N40O45

Massa molare: 3297.6

Sequenza: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR

Quantità unitaria: 1 flaconcino

Aspetto: polvere bianca

Purezza del peptide:> 99%

Informazioni aggiuntive

Misurare

2 mg, 10 mg

Recensioni

Ancora non ci sono recensioni.

Recensisci per primo “GLP-1”

Il tuo indirizzo email non sarà pubblicato.