GLP-1

GLP-1, a peptide generated in the gut, helps control blood sugar levels in people with diabetes. In addition, according to new research, GLP-1 (glucagon-like peptide 1) may strengthen lung, liver, and heart function while slowing the progression of Alzheimer’s disease. This peptide, also identified as Liraglutide, works by slowing down intestinal motility and delaying gastric emptying to reduce hunger.

£31,99£143,99

Availability: In stock

Clear

Description

What Exactly is GLP-1:

GLP-1 is a 30-31 amino acid peptide that occurs in nature.

Blood sugar levels are lowered by boosting insulin secretion as a primary function of GLP-1. In addition, insulin gene transcription is protected in beta cells thanks to the hormone’s role in promoting insulin gene transcription. Peptide GLP 1 can also reduce appetite and enhance the health of the heart, lungs, bones and kidneys, and the rest of the body.

Pre-proglucagon, a polypeptide that produced glucagon and other hormones, yielded GLP1, a member of the incretin hormone family. These hormones are referred to as “glucagon-like” since they share many similarities with glucagon, which they both derive from.

The main source of GLC-1 peptide is L-cells, which are small intestinal cells. The pancreas and central nervous system do secrete it as well but in much smaller amounts.


What is GLP-1 Known For?

GLP-1, a peptide generated in the gut, helps control blood sugar levels in people with diabetes. In addition, according to new research, GLP-1 (glucagon-like peptide 1) may strengthen lung, liver, and heart function while slowing the progression of Alzheimer’s disease. This peptide, also identified as Liraglutide, works by slowing down intestinal motility and delaying gastric emptying to reduce hunger.

Researchers are currently concentrating their efforts on the effects of GLP-1 peptide on diabetes treatment and prevention and appetite suppression. Its potential cardiovascular effects, however, are a significant source of research interest. Another area of research for scientists is whether the GLP-1 hormone can protect against neurodegenerative diseases like Alzheimer’s.


Studies:

https://clinicaltrials.gov/ct2/show/NCT03959865


Effects:

Diabetes
The effects of Glp-1 on diabetes are significant. A cluster of metabolic hormones lowers blood sugar levels due to the incretin effect, which is caused by the human glucagon-like peptide. GLP-1 is the more powerful of the two hormones when high blood sugar is present, but both hormones stimulate the effect.

GLP-1 receptors have been located on the surface of pancreatic beta cells, suggesting that the peptide directly encourages insulin’s mobility from the pancreas. According to new research, taking GLP-1 with sulfonylurea drugs can cause mild hypoglycemia by increasing insulin secretion.

Protein synthesis, amino acid absorption by the muscle, and protein breakdown are enhanced when insulin secretion increases.

Losing weight
GLP-1 weight loss supplements are popular because they help people lose weight by suppressing their appetites and increasing fat loss. However, due to a lack of clinical trials, it is not yet FDA-approved and should only be used in medical research. Even so, the part GLP 1 plays in weight loss are intriguing.

Researchers have discovered that injecting GLP-1 into the brains of mice reduces their appetite and thus their intake of food. As a result, it may increase feelings of satiety, helping people avoid overeating. In addition, GLP 1 peptide administration twice daily resulted in weight loss and improved cardiovascular health.

Brain
GLP-1 hormone peptide has been shown in studies to improve learning and safeguard against neurodegenerative diseases such as Alzheimer’s and other similar conditions. GLP-1 improved spatial and associative learning in mice to help people with learning disabilities caused by genetic defects, according to a study.

Heart
Research shows that GLP 1 receptors are found all over the heart, optimising cardiac function by increasing heart rate and decreasing left ventricular end-diastolic pressure (LVEP). Reduced LV end-diastolic stress significantly impacts cardiovascular health because it is closely linked to cardiac remodelling, hypertrophy, and cardiac arrest.

Research indicates that glucagon peptide can help prevent cardiac arrest-related brain damage. And it does so by assisting weaker muscle cells in better function and preventing cell death through the GLP1 peptide.


Side Effects:

Taking GLP-1 comes with a possible risk of weight gain. The most significant danger here is that a person will become obese if they do not have enough natural GLP-1 production in their bodies.

This peptide is generally considered to be risk-free and safe to use. Furthermore, scientists believe that the advantages of GLP 1 far outweigh the minor disadvantages.

Individuals with a history of thyroid cancer should avoid taking GLP-1 peptide because studies in rodent models have linked these hormones to thyroid tumours.


Formula: C149H226N40O45

Molar mass: 3297.6

Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR

Unit Quantity: 1 Vial

Appearance: White Powder

Peptide Purity: >99%

Additional information

Size

2mg, 10mg

Reviews

There are no reviews yet.

Be the first to review “GLP-1”

Your email address will not be published. Required fields are marked *