(€) EUR (Default)
  • (£) GBP
  • ($) USD
  • ($) AUD
  • ($) CAD
FOX04-DRI

FOX04-DRI

La protéine synthétique FOX04-DRI est une légère modification de la protéine FOX04 originale. Le changement prolonge la demi-vie de la protéine, lui permettant de perturber la fonction normale de FOX04. En conséquence, les cellules sénescentes peuvent être éliminées, la fonction des organes améliorée et « l’âge biologique » des tissus est raccourci grâce à FOX04-DRI. En plus de la signalisation de l’insuline, FOX04-DRI a un impact sur le contrôle du cycle cellulaire et les voies de signalisation du stress oxydatif. De plus, il a été démontré dans des études animales que le peptide pénétrant dans les cellules FOX04-DRI induisait sélectivement l’apoptose dans les cellules gériatriques, inversant les effets du processus de vieillissement.

235.99

Availability: In stock

Description

Qu’est-ce que FOX04-DRI exactement :

En utilisant Foxo4-dri, un peptide anti-âge, la communication du gène p53 est coupée, entraînant la mort des cellules sénescentes. La recherche suggère que ce peptide, s’il est étudié plus avant, pourrait aider les gens à vivre plus longtemps et à avoir une vie plus saine en réduisant le nombre de cellules sénescentes dans leur corps.

Cellules sénescentes : les cellules entrent en sénescence à mesure que vous vieillissez, ce qui signifie qu’elles ne peuvent plus distribuer ou maintenir les tissus auxquels elles appartiennent. Les cellules voisines deviennent sénescentes sous l’effet des signaux chimiques toxiques émis par ces cellules vieillissantes. Lorsque ces cellules sont présentes, la fonction tissulaire se détériore, l’inflammation augmente et le risque de cancer augmente.

FOXO4 a été trouvé pour réduire le développement de ces cellules nocives, selon des études. Essentiellement, le peptide hormonal FOXO4 peut trouver et détruire les cellules sénescentes lorsqu’il est administré en quantités suffisantes.


Pourquoi FOX04-DRI est-il connu ?

Les effets anti-âge de FOXO4 DRI
Un large éventail de facteurs influence le vieillissement. Cependant, la sénescence cellulaire, qui est stimulée lorsque vos télomères expirent, en est la principale cause.

Lorsque vos cellules se divisent, l’ADN de vos chromosomes est répliqué dans chaque nouvelle cellule. Cette méthode, cependant, est truffée de défauts et finit par éliminer de petites quantités d’ADN. Heureusement, les télomères sont là pour sauver l’extrémité de vos chromosomes de l’extinction.

Les télomères sont essentiellement un déchet du génome. Jusqu’à 70 divisions ne sont pas rares pour ces choses. Cependant, s’ils s’épuisent, ils envoient des signaux aux cellules, provoquant la sénescence des anciens sains.

Des essais cliniques ont montré que FOX04 DRI est un traitement efficace pour stopper la propagation de ces cellules une fois qu’elles ont commencé.

Efficacité de FOXO4 dans la promotion de la croissance des cheveux
Selon les recherches, les conditions génétiques de perte de cheveux comme la calvitie féminine et la calvitie masculine peuvent être aidées par l’hormone FOXO4 DRI.

Grâce à la recherche, les scientifiques ont découvert que FOXO4 augmente l’épaisseur et la densité des cheveux en réduisant la production de cellules sénescentes.

Selon les recherches, les souris ayant reçu FOXo4 DRI pour la perte de cheveux avaient une fourrure plus épaisse et moins de calvitie.

Maladie cardiaque et FOXO4 DRI
L’activité du protéasome du cœur diminue avec l’âge, ce qui augmente le risque de maladie cardiovasculaire. Cependant, lorsque la cellule détecte des protéines oxydées et d’autres protéines défectueuses, les protéasomes se mettent au travail pour les éliminer.

Selon des recherches sur les rats, l’âge et l’activité du protéasome sont liés, ce qui entraîne des niveaux plus élevés de protéines endommagées dans le cœur.

Les protéines FOXO facilitent grandement l’autophagie et l’activité du protéasome. L’augmentation des niveaux de FOX04 augmente l’activité du protéasome, ce qui réduit le stress oxydatif et les lésions tissulaires.

Les scientifiques ont conclu que FOXO4-DRI peut augmenter les fonctions primaires du cœur et réduire les changements dans les rôles cardiovasculaires associés au vieillissement.

Effets de FOXO4 sur la neurodégénérescence
À la suite de ces études, les chercheurs pensent que les protéines FOXO4 DRI peuvent aider à traiter et à prévenir les maladies neurodégénératives. De plus, les chercheurs espèrent que ce peptide ralentira l’apparition de maladies neurodégénératives.

La maladie d’Alzheimer et d’autres formes de démence sont encore mal comprises par les professionnels de la santé. En conséquence, les scientifiques ont besoin de plus de recherches sur les résultats de FOXO4 DRI pour déterminer les effets potentiels du peptide sur les patients et pour assurer la sécurité des patients.

Bien que les effets de FOXO4-DRI sur les conditions liées au vieillissement soient prometteurs, des recherches supplémentaires sont nécessaires avant que le supplément puisse être approuvé pour la consommation humaine.


Études:

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5556182/


Effets:

Il s’appelle FOXO4-DRI (forkhead box O4), et il agit en induisant sélectivement la mort cellulaire dans les vieilles cellules pour contrer le processus de vieillissement chez les animaux.

Le gène FOXO4 a des propriétés anti-âge et anti-tumorales dans un seul emballage.

FOXO4-DRI est le sénolytique le plus puissant actuellement à l’étude. En conséquence, les personnes âgées qui prennent ce supplément peuvent vivre plus longtemps et connaître moins de déclin cognitif.


Effets secondaires:

Des études de recherche ont montré que les effets secondaires de FOXO4 sont minimes lorsqu’il est administré par voie orale ou sous-cutanée à faibles doses chez la souris. Cependant, seuls les chercheurs agréés peuvent actuellement acheter FOXO4 à des fins éducatives et scientifiques.


Formule : C228H388N86O64

Masse molaire : 5358,05

Séquence : H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH

Quantité unitaire : 1 flacon

Apparence : poudre blanche

Pureté des peptides :> 99%

Avis

Il n’y a pas encore d’avis.

Soyez le premier à laisser votre avis sur “FOX04-DRI”

Votre adresse e-mail ne sera pas publiée.