(€) EUR (Default)
  • (£) GBP
  • ($) USD
  • ($) AUD
  • ($) CAD
GLP-1 Flacon de 2 mg

BPL-1

Le GLP-1, un peptide généré dans l’intestin, aide à contrôler la glycémie chez les personnes atteintes de diabète. De plus, selon de nouvelles recherches, le GLP-1 (glucagon-like peptide 1) pourrait renforcer les fonctions pulmonaire, hépatique et cardiaque tout en ralentissant la progression de la maladie d’Alzheimer. Ce peptide, également identifié sous le nom de Liraglutide, agit en ralentissant la motilité intestinale et en retardant la vidange gastrique pour réduire la faim.

31.99143.99

Availability: In stock

Effacer

Description

Qu’est-ce que le GLP-1 exactement :

Le GLP-1 est un peptide de 30 à 31 acides aminés présent dans la nature.

Les niveaux de sucre dans le sang sont abaissés en augmentant la sécrétion d’insuline en tant que fonction principale du GLP-1. De plus, la transcription du gène de l’insuline est protégée dans les cellules bêta grâce au rôle de l’hormone dans la promotion de la transcription du gène de l’insuline. Le peptide GLP 1 peut également réduire l’appétit et améliorer la santé du cœur, des poumons, des os et des reins, et du reste du corps.

Le pré-proglucagon, un polypeptide qui produit du glucagon et d’autres hormones, a produit du GLP1, un membre de la famille des hormones incrétines. Ces hormones sont appelées « glucagon-like » car elles partagent de nombreuses similitudes avec le glucagon, dont elles dérivent toutes les deux.

La principale source de peptide GLC-1 est les cellules L, qui sont de petites cellules intestinales. Le pancréas et le système nerveux central en sécrètent également, mais en quantités beaucoup plus faibles.


Pourquoi le GLP-1 est-il connu ?

Le GLP-1, un peptide généré dans l’intestin, aide à contrôler la glycémie chez les personnes atteintes de diabète. De plus, selon de nouvelles recherches, le GLP-1 (glucagon-like peptide 1) pourrait renforcer les fonctions pulmonaire, hépatique et cardiaque tout en ralentissant la progression de la maladie d’Alzheimer. Ce peptide, également identifié sous le nom de Liraglutide, agit en ralentissant la motilité intestinale et en retardant la vidange gastrique pour réduire la faim.

Les chercheurs concentrent actuellement leurs efforts sur les effets du peptide GLP-1 sur le traitement et la prévention du diabète et la suppression de l’appétit. Ses effets cardiovasculaires potentiels, cependant, sont une source importante d’intérêt pour la recherche. Un autre domaine de recherche pour les scientifiques est de savoir si l’hormone GLP-1 peut protéger contre les maladies neurodégénératives comme la maladie d’Alzheimer.


Études:

https://clinicaltrials.gov/ct2/show/NCT03959865


Effets:

Diabète
Les effets du Glp-1 sur le diabète sont importants. Un groupe d’hormones métaboliques abaisse le taux de sucre dans le sang en raison de l’effet incrétine, qui est causé par le peptide de type glucagon humain. Le GLP-1 est la plus puissante des deux hormones en cas d’hyperglycémie, mais les deux hormones stimulent l’effet.

Les récepteurs GLP-1 ont été localisés à la surface des cellules bêta pancréatiques, suggérant que le peptide encourage directement la mobilité de l’insuline à partir du pancréas. Selon de nouvelles recherches, la prise de GLP-1 avec des sulfonylurées peut provoquer une légère hypoglycémie en augmentant la sécrétion d’insuline.

La synthèse des protéines, l’absorption des acides aminés par le muscle et la dégradation des protéines sont améliorées lorsque la sécrétion d’insuline augmente.

Perdre du poids
Les suppléments de perte de poids GLP-1 sont populaires car ils aident les gens à perdre du poids en supprimant leur appétit et en augmentant la perte de graisse. Cependant, en raison d’un manque d’essais cliniques, il n’est pas encore approuvé par la FDA et ne devrait être utilisé que dans la recherche médicale. Même ainsi, le rôle que joue le GLP 1 dans la perte de poids est intrigant.

Des chercheurs ont découvert que l’injection de GLP-1 dans le cerveau de souris réduit leur appétit et donc leur consommation de nourriture. En conséquence, cela peut augmenter le sentiment de satiété, aidant les gens à éviter de trop manger. De plus, l’administration du peptide GLP 1 deux fois par jour a entraîné une perte de poids et une amélioration de la santé cardiovasculaire.

Cerveau
Il a été démontré dans des études que le peptide hormonal GLP-1 améliore l’apprentissage et protège contre les maladies neurodégénératives telles que la maladie d’Alzheimer et d’autres affections similaires. Selon une étude, le GLP-1 a amélioré l’apprentissage spatial et associatif chez la souris pour aider les personnes ayant des troubles d’apprentissage causés par des défauts génétiques.

Cœur
La recherche montre que les récepteurs GLP 1 se trouvent partout dans le cœur, optimisant la fonction cardiaque en augmentant la fréquence cardiaque et en diminuant la pression télédiastolique ventriculaire gauche (LVEP). La réduction du stress télédiastolique du VG a un impact significatif sur la santé cardiovasculaire car elle est étroitement liée au remodelage cardiaque, à l’hypertrophie et à l’arrêt cardiaque.

La recherche indique que le peptide glucagon peut aider à prévenir les lésions cérébrales liées à un arrêt cardiaque. Et il le fait en aidant les cellules musculaires les plus faibles à mieux fonctionner et en empêchant la mort cellulaire grâce au peptide GLP1.


Effets secondaires:

La prise de GLP-1 comporte un risque possible de prise de poids. Le danger le plus important ici est qu’une personne devienne obèse si elle n’a pas suffisamment de production naturelle de GLP-1 dans son corps.

Ce peptide est généralement considéré comme sans risque et sûr à utiliser. De plus, les scientifiques pensent que les avantages du GLP 1 l’emportent largement sur les inconvénients mineurs.

Les personnes ayant des antécédents de cancer de la thyroïde devraient éviter de prendre le peptide GLP-1 car des études sur des modèles de rongeurs ont lié ces hormones aux tumeurs de la thyroïde.


Formule : C149H226N40O45

Masse molaire : 3297,6

Séquence : HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR

Quantité unitaire : 1 flacon

Apparence : poudre blanche

Pureté des peptides :> 99%

Informations complémentaires

Taille

2mg, 10mg

Avis

Il n’y a pas encore d’avis.

Soyez le premier à laisser votre avis sur “BPL-1”

Votre adresse e-mail ne sera pas publiée.