(€) EUR (Default)
  • (£) GBP
  • ($) USD
  • ($) AUD
  • ($) CAD
FOX04-DRI

FOX04-DRI

Das synthetische FOX04-DRI-Protein ist eine leichte Modifikation des ursprünglichen FOX04-Proteins. Die Veränderung verlängert die Halbwertszeit des Proteins, wodurch es die normale FOX04-Funktion stören kann. Dadurch können seneszente Zellen eliminiert, die Organfunktion verbessert und das „biologische Alter“ des Gewebes dank FOX04-DRI verkürzt werden. Zusätzlich zur Insulinsignalisierung beeinflusst FOX04-DRI die Zellzykluskontrolle und die Signalwege für oxidativen Stress. Darüber hinaus wurde in Tierversuchen gezeigt, dass das zellpenetrierende Peptid FOX04-DRI in geriatrischen Zellen selektiv Apoptose induziert und die Auswirkungen des Alterungsprozesses umkehrt.

235.99

Availability: In stock

Beschreibung

Was genau ist FOX04-DRI:

Mit Foxo4-dri, einem Anti-Aging-Peptid, wird die p53-Genkommunikation unterbrochen, was zum Absterben seneszenter Zellen führt. Forschungsergebnisse deuten darauf hin, dass dieses Peptid, wenn es weiter untersucht wird, Menschen helfen könnte, länger und gesünder zu leben, indem es die Anzahl alternder Zellen in ihrem Körper reduziert.

Seneszente Zellen: Zellen altern mit zunehmendem Alter, was bedeutet, dass sie das Gewebe, zu dem sie gehören, nicht mehr verteilen oder erhalten können. Benachbarte Zellen altern aufgrund der toxischen chemischen Signale, die von diesen alternden Zellen ausgesendet werden. Wenn diese Zellen vorhanden sind, verschlechtert sich die Gewebefunktion, die Entzündung nimmt zu und das Krebsrisiko steigt.

Studien haben gezeigt, dass FOXO4 die Entwicklung dieser schädlichen Zellen reduziert. Im Wesentlichen kann das FOXO4-Hormonpeptid seneszente Zellen finden und zerstören, wenn es in ausreichenden Mengen verabreicht wird.


Wofür ist FOX04-DRI bekannt?

Die Anti-Aging-Wirkung von FOXO4 DRI
Eine Vielzahl von Faktoren beeinflusst das Altern. Die Hauptursache ist jedoch die zelluläre Seneszenz, die stimuliert wird, wenn Ihre Telomere ablaufen.

Wenn sich Ihre Zellen teilen, wird die DNA Ihrer Chromosomen in jeder neuen Zelle repliziert. Diese Methode ist jedoch voller Fehler und führt dazu, dass kleine Mengen an DNA entfernt werden. Glücklicherweise sind Telomere vorhanden, um das äußerste Ende Ihrer Chromosomen vor dem Aussterben zu bewahren.

Telomere sind im Wesentlichen ein Abfallprodukt des Genoms. Bis zu 70 Teilungen sind bei diesen Dingen keine Seltenheit. Gehen sie jedoch zur Neige, senden sie Signale an die Zellen, wodurch die ehemals Gesunden altern.

Klinische Studien haben gezeigt, dass FOX04 DRI eine wirksame Behandlung ist, um die Ausbreitung dieser Zellen zu stoppen, sobald sie begonnen haben.

Wirksamkeit von FOXO4 bei der Förderung des Haarwachstums
Untersuchungen zufolge können genetisch bedingte Haarausfallerkrankungen wie Haarausfall bei Frauen und Haarausfall bei Männern durch das Hormon FOXO4 DRI unterstützt werden.

Durch Forschung haben Wissenschaftler entdeckt, dass FOXO4 die Haardicke und -dichte erhöht, indem es die Produktion seneszenter Zellen reduziert.

Untersuchungen zufolge hatten Mäuse, denen FOXo4 DRI gegen Haarausfall verabreicht wurde, dickeres Fell und weniger Kahlköpfigkeit.

Herzerkrankungen und der FOXO4 DRI
Die Proteasomaktivität des Herzens nimmt mit zunehmendem Alter ab, was das Risiko für Herz-Kreislauf-Erkrankungen erhöht. Wenn die Zelle jedoch oxidierte Proteine und andere fehlerhafte Proteine entdeckt, machen sich Proteasome an die Arbeit, um sie zu entfernen.

Laut Rattenforschung sind Alter und Proteasomaktivität miteinander verbunden, was zu einem höheren Gehalt an beschädigten Proteinen im Herzen führt.

FOXO-Proteine erleichtern die Autophagie und die Proteasomaktivität erheblich. Erhöhte FOX04-Spiegel erhöhen die Proteasomaktivität, wodurch oxidativer Stress und Gewebeschäden reduziert werden.

Wissenschaftler sind zu dem Schluss gekommen, dass FOXO4-DRI die Primärfunktionen des Herzens verbessern und altersbedingte Veränderungen der kardiovaskulären Funktionen reduzieren kann.

Auswirkungen von FOXO4 auf Neurodegeneration
Als Ergebnis dieser Studien glauben Forscher, dass FOXO4-DRI-Proteine bei der Behandlung und Vorbeugung von neurodegenerativen Erkrankungen helfen können. Darüber hinaus hoffen die Forscher, dass dieses Peptid den Ausbruch neurodegenerativer Erkrankungen verlangsamen wird.

Die Alzheimer-Krankheit und andere Formen der Demenz werden von Medizinern immer noch kaum verstanden. Infolgedessen müssen Wissenschaftler die Ergebnisse von FOXO4 DRI weiter erforschen, um die potenziellen Auswirkungen des Peptids auf Patienten zu bestimmen und die Patientensicherheit zu gewährleisten.

Obwohl die Auswirkungen von FOXO4-DRI auf altersbedingte Erkrankungen vielversprechend sind, ist weitere Forschung erforderlich, bevor das Nahrungsergänzungsmittel für den menschlichen Verzehr zugelassen werden kann.


Studien:

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5556182/


Auswirkungen:

Es heißt FOXO4-DRI (Forkhead Box O4) und wirkt, indem es den Zelltod in alten Zellen selektiv induziert, um dem Alterungsprozess bei Tieren entgegenzuwirken.

Das FOXO4-Gen hat Anti-Aging- und tumorunterdrückende Eigenschaften in einem Paket.

FOXO4-DRI ist das wirksamste Senolytikum, das derzeit untersucht wird. Infolgedessen können ältere Menschen, die diese Ergänzung einnehmen, länger leben und einen geringeren kognitiven Rückgang erfahren.


Nebenwirkungen:

Forschungsstudien haben gezeigt, dass die Nebenwirkungen von FOXO4 bei oraler oder subkutaner Verabreichung in niedrigen Dosen bei Mäusen minimal sind. Derzeit können jedoch nur lizenzierte Forscher FOXO4 für Bildungs- und wissenschaftliche Zwecke erwerben.


Formel: C228H388N86O64

Molmasse: 5358,05

Sequenz: H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH

Einheitsmenge: 1 Fläschchen

Aussehen: Weißes Pulver

Peptidreinheit:> 99%

Bewertungen

Es gibt noch keine Bewertungen.

Schreibe die erste Bewertung für „FOX04-DRI“

Deine E-Mail-Adresse wird nicht veröffentlicht.