IGF-1 LR3

IGF-1 LR3 è un prodotto GH (ormone della crescita) che promuove la crescita cellulare in tutto il corpo, consentendo il rafforzamento dei tessuti, una maggiore densità ossea e il recupero, la crescita e lo sviluppo.

40.99100.99

Availability: In stock

Svuota

Descrizione

Che cosa è esattamente IGF-1 LR3:

IGF-1 LR3 è un prodotto GH (ormone della crescita) che promuove la crescita cellulare in tutto il corpo, consentendo il rafforzamento dei tessuti, una maggiore densità ossea e il recupero, la crescita e lo sviluppo.

In termini di affinità per le proteine che legano il fattore di crescita simile all’insulina, il peptide IGF-1 LR3 ha un totale di 83 aminoacidi e ha mostrato un rapido miglioramento della stabilità metabolica. Ciò lo rende un peptide tre volte più potente dello stesso IGF-1.

Si pensa che IGF-1 LR3 abbia la funzione primaria di aumentare l’attività biologica dell’IGF. Tessuti diversi rispondono in modo diverso all’IGF-1 LR3 quando è attivo nel corpo. L’IGF-1 LR3 utilizzato nel tessuto muscolare, ad esempio, aumenterebbe la sensibilità del muscolo agli effetti dell’insulina. Quando aumenti la massa muscolare, bruci più calorie, il che può portare alla perdita di grasso, ma puoi anche causare un aumento di grasso nel processo.

L’IGF1 è principalmente legato all’ormone della crescita umano, che protegge i tessuti del corpo dal deterioramento. Poiché è prodotto nel fegato, la ghiandola pituitaria, una minuscola stenosi alla base del cervello, è responsabile della produzione di questo lungo peptide. La produzione e la secrezione di ormoni sono tenute sotto controllo dal sistema endocrino. Oltre a ciò, controlla i livelli di acqua del corpo, segnala la produzione di latte nelle donne incinte e accelera il metabolismo. Inoltre, IGF1 LR3 contribuisce alla produzione di ormoni sessuali ed è essenziale per la crescita umana.


Per cosa è noto IGF-1 LR3?

C’è una differenza significativa nella potenza tra IGF-1 LR3 e IGF-1. L’aumento della potenza di IGF-1 LR3 deriva da un minor legame con tutte le proteine leganti IGF note da parte di IGF-1 LR3. Queste proteine leganti di solito inibiscono le azioni biologiche dell’IGF. Tessuti diversi rispondono in modo diverso all’IGF quando è attivo. Le proteine e altri componenti cellulari vengono attivati nelle cellule muscolari. L’assorbimento degli aminoacidi e la sintesi proteica sono entrambi aumentati. L’IGF mobilita il grasso per utilizzarlo come energia nel tessuto adiposo come fonte di carburante.

  • Aumenta la sintesi proteica mentre fornisce nutrienti direttamente alle cellule e ai muscoli per il massimo effetto.
  • Promuove la crescita muscolare riducendo il grasso corporeo.
  • Il grasso viene mobilitato dall’IGF e utilizzato come energia nel tessuto adiposo.
  • Causa anche iperplasia, che è un aumento del numero di cellule muscolari.
  • Ha il potenziale per alterare la capacità di una persona di aumentare la densità e le dimensioni muscolari.

Studi:

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5750484/


Effetti:

  • Aumento della riparazione cellulare, rigenerazione totale del corpo (compresi gli organi interni)
  • Inibendo il processo di invecchiamento e ringiovanimento, oltre a rallentare il processo di invecchiamento
  • La produzione di collagene aumenta, la pelle diventa più sana e di conseguenza le rughe si riducono.
  • Forte effetto anabolico/promuove la crescita, la forza e le prestazioni del tessuto muscolare
  • Capacità di indurre iperplasia muscolare
  • Forte effetto anticatabolico che preserva i muscoli
  • Un livello elevato di contenuto o densità minerale ossea
  • Migliora i processi di apprendimento e memoria nel cervello
  • Ringiovanisce il sistema nervoso e il cervello.
  • Questo integratore ha il potenziale per ridurre il rischio di malattie cardiache e dei vasi sanguigni.
  • Migliori difese contro le infezioni
  • Effetti sull’infiammazione antinfiammatoria
  • Miglioramento della salute dell’intestino

Effetti collaterali:

Gli studi sulla sicurezza non hanno mostrato effetti avversi associati all’uso di IGF-1 LR3.

Più medici e scienziati stanno ricercando i benefici del peptide IGF-1 LR3 ora che l’innovazione medica è in aumento. Finora i ricercatori hanno visto alcuni effetti impressionanti da questo peptide e si aspettano di trovarne altri man mano che la ricerca continua.


Formula: C400H625N111O115S9

Massa molare: 9.1k

Sequenza: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA

Quantità unitaria: 1 fiala

Aspetto: polvere bianca

Purezza peptidica:> 99%

Informazioni aggiuntive

Misurare

01.mg, 1 mg

Recensioni

Ancora non ci sono recensioni.

Recensisci per primo “IGF-1 LR3”

Il tuo indirizzo email non sarà pubblicato. I campi obbligatori sono contrassegnati *