IGF-1 LR3 For Sale

IGF-1 LR3 is a lab-engineered version of insulin-like growth factor-1 (IGF-1), designed to boost its effectiveness. With 83 amino acids, it is recognized for its role in promoting lean muscle growth, enhancing recovery, and supporting fat loss. Research indicates its potential to improve metabolism and combat muscle wasting, though ongoing studies continue to explore its broader applications.

Price range: $21.13 through $379.69

Availability:Β In stock

Description

What is IGF-1 LR3?

GF-1 LR3, or Insulin-like Growth Factor 1 Long R3, is a synthetic peptide created in the lab to mimic the natural hormone IGF-1, a synthetic protein similar in structure to insulin. The term β€œLong R3” refers to changes in the molecule that give it a longer half-life and make it more effective in research settings than natural IGF-1.

Researchers exploring IGF-1 LR3 for sale from My Peptides have focused on its enhanced potency for research purposes, particularly for studying muscle tissue growth, cellular growth, improved bone density, fat loss and muscle repair, all contributing to athletic performance (1).

Naturally, IGF-1 is produced in the liver and helps growth hormone (GH) with important functions like muscle growth, development, and repair. This modified version has been designed to avoid binding with IGF-binding proteins (IGFBPs), which improves its bioavailability and makes it last longer in the body.

Because of these features, scientists use this peptide in studies to better understand cell growth, protein synthesis, and metabolic pathways, further driving interest in IGF-1 LR3 for sale from My Peptides.


Key Characteristics of IGF-1 LR3:

  • Extended Half-Life: IGF-1 LR3 has a high purity half-life of approximately 20–30 hours compared to the natural IGF-1’s 12–15 minutes.
  • Modification: The substitution of long arginine at position 3 and additional amino acid sequences reduce its affinity for IGFBPs, improving its potency and bioavailability.
  • Purpose: Exclusively intended for use in laboratory research use to explore cellular growth mechanisms and biological processes.

How Does IGF-1 LR3 Work?

IGF-1 LR3 for sale from My Peptides works by attaching to IGF-1 receptors on cell surfaces. This interaction triggers internal signals in cells that control growth, replication, hypertrophy, fat metabolism, and survival. Its stable structure and longer half-life allow IGF-1 LR3, a high-quality research peptide, to stay active in biological systems for a longer time, giving researchers more consistent data during studies.

Mechanism of Action

1.Receptor Binding

IGF-1 LR3 binds to IGF-1 receptors on target cells, activating key signalling pathways like PI3K-Akt and MAPK. These pathways help regulate growth, metabolism, and tissue repair.

2. Reduced Binding to IGFBPs

The modified structure of IGF-1 LR3 limits its interaction with IGF-binding proteins (IGFBPs), enhancing its efficacy and biological activity in experimental models, further driving demand for IGF-1 LR3 for sale from My Peptides.

3. Cellular Impact

Once attached to receptors, IGF-1 LR3 influences gene expression and protein synthesis needed for cell division and growth. Researchers use these properties to study tissue repair, muscle mass growth, and muscle repair processes.

These actions make IGF-1 LR3 for sale from My Peptides a valuable research tool for exploring how anabolic processes work and for theoretical studies on its potential applications in addressing muscle wasting, growth hormone deficiency, and other conditions.


What are the Potential Benefits of IGF-1 LR3?

From a research perspective, IGF-1 LR3 For Sale from My Peptides offers promising benefits, including ease of use, that make it widely used by licenced researchers for precision in laboratory studies. These benefits apply only to research and have no relevance to human use. For those interested, pure peptides UK is a dependable source.

  • Cell Growth and Regeneration

IGF-1 LR3 helps promote cell growth and tissue repair. Research shows it supports cell replication and regeneration, providing insights into wound healing and recovery processes (2).

  • Protein Synthesis

Studies indicate IGF-1 LR3 boosts protein synthesis, which is key for lean muscle development and repair. Researchers use it to explore how anabolic pathways work in controlled experiments.

  • Extended Functional Activity

The long half-life of IGF-1 LR3 allows researchers to study its effects over a longer period without frequent re-administration. This makes it highly useful in laboratory studies (3).

  • Insights into Metabolic Pathways

IGF-1 LR3 For Sale from My Peptides helps researchers understand how peptide hormones control metabolic pathways. These findings are valuable for studying metabolic disorders (4).

These benefits highlight of IGF-1 LR3 For Sale from My Peptides importance in scientific research. However, all studies are strictly conducted in laboratory settings, and these findings do not represent medical advice.


Does IGF-1 LR3 Have Any Side Effects?

IGF-1 LR3, while effective as a research tool, may exhibit side effects in laboratory experiments. Monitoring these effects is crucial to ensure both scientific accuracy and safety. One potential side effect is cellular overgrowth, where elevated concentrations may lead to uncontrolled cell proliferation in experimental models.

This highlights the importance of precise dosage management during studies. Another observed effect is hypoglycaemia, as IGF-1 shares similarities with insulin.

Some animal studies report low blood sugar levels, necessitating close monitoring. Additionally, prolonged exposure to IGF-1 LR3 may disrupt natural feedback mechanisms, interfering with the regulation of growth hormone and IGF-1 levels in controlled environments. IGF-1 LR3 For Sale from My Peptides is for research use only.


IGF-1 LR3 Specifications

Formula: C400H625N111O115S9

Molar mass: 9.1k

Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRG FYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA

Unit Quantity: 1 Vial

Appearance: White Powder

Peptide Purity: >99%


Discover premium quality IGF-1 LR3 For Sale from My Peptides. Our IGF-1 LR3 Peptide Vials are guaranteed 99% purity and are available in 0.1mg and 1mg for research. IGF-1 LR3 For Sale supplements from My Peptides is for research use only.


Scientific Research

(1) Gehmert S, Wenzel C, Loibl M, Brockhoff G, Huber M, Krutsch W, Nerlich M, Gosau M, Klein S, Schreml S, Prantl L, Gehmert S. Adipose tissue-derived stem cell secreted IGF-1 protects myoblasts from the negative effect of myostatin. Biomed Res Int. 2014;2014:129048.

(2) Provenzano PP, Alejandro-Osorio AL, Grorud KW, Martinez DA, Vailas AC, Grindeland RE, Vanderby R Jr. Systemic administration of IGF-I enhances healing in collagenous extracellular matrices: evaluation of loaded and unloaded ligaments. BMC Physiol. 2007 Mar 26;7:2.

(3) Sonntag WE, Csiszar A, deCabo R, Ferrucci L, Ungvari Z. Diverse roles of growth hormone and insulin-like growth factor-1 in mammalian aging: progress and controversies. J Gerontol A Biol Sci Med Sci. 2012 Jun;67(6):587-98.

(4) Bailes J, Soloviev M. Insulin-Like Growth Factor-1 (IGF-1) and Its Monitoring in Medical Diagnostic and in Sports. Biomolecules. 2021 Feb 4;11(2):217.


ALL PRODUCT INFORMATION AND ARTICLES ON THIS SITE ARE INTENDED FOR EDUCATIONAL PURPOSES ONLY.

DISCLAIMER: All products sold by My Peptides are strictly intended for research and laboratory use only. These items are not designed for human or animal use or consumption. They are not classified as drugs, food, cosmetics, or medicinal products and must not be mislabeled or misused as such. By purchasing from our website, buyers acknowledge and accept all risks associated with handling these materials. The information and articles provided on this website are purely for educational and informational purposes. Handling and usage of these products should be carried out exclusively by qualified professionals.

Additional information

Size

0.1mg, 1mg, 0.1mg x 5, 1mg x 5