IGF-1 LR3

IGF-1 LR3 est un produit à base d’hormone de croissance (GH) qui favorise la croissance cellulaire dans tout le corps, permettant le renforcement des tissus, une meilleure densité osseuse, ainsi que la récupération, la croissance et le développement.

40.99100.99

Availability: In stock

Effacer

Description

Qu’est-ce que l’IGF-1 LR3 exactement:

IGF-1 LR3 est un produit à base d’hormone de croissance (GH) qui favorise la croissance cellulaire dans tout le corps, permettant le renforcement des tissus, une meilleure densité osseuse, ainsi que la récupération, la croissance et le développement.

En termes d’affinité pour les protéines de liaison au facteur de croissance analogues à l’insuline, le peptide IGF-1 LR3 possède un total de 83 acides aminés et a montré une amélioration rapide de la stabilité métabolique. Cela en fait un peptide trois fois plus puissant que l’IGF-1 lui-même.

On pense que l’IGF-1 LR3 a pour fonction principale d’augmenter l’activité biologique de l’IGF. Différents tissus réagissent différemment à l’IGF-1 LR3 lorsqu’il est actif dans le corps. L’IGF-1 LR3 utilisé dans le tissu musculaire, par exemple, augmenterait la sensibilité du muscle aux effets de l’insuline. Lorsque vous augmentez votre masse musculaire, vous brûlez plus de calories, ce qui peut entraîner une perte de graisse, mais vous pouvez également entraîner une prise de graisse dans le processus.

IGF1 est principalement lié à l’hormone de croissance humaine, qui protège les tissus du corps contre la détérioration. Parce qu’il est fabriqué dans le foie, l’hypophyse, une minuscule sténose à la base du cerveau, est responsable de la production de ce long peptide. La production et la sécrétion d’hormones sont contrôlées par le système endocrinien. En plus de cela, il contrôle les niveaux d’eau du corps, signale la production de lait chez les femmes enceintes et accélère le métabolisme. De plus, IGF1 LR3 contribue à la production d’hormones sexuelles et est essentiel à la croissance humaine.


Pour quoi l’IGF-1 LR3 est-il connu?

Il existe une différence significative de puissance entre IGF-1 LR3 et IGF-1. La puissance accrue de l’IGF-1 LR3 résulte d’une liaison moindre à toutes les protéines de liaison IGF connues par l’IGF-1 LR3. Ces protéines de liaison inhibent généralement les actions biologiques de l’IGF. Différents tissus réagissent différemment à l’IGF lorsqu’il est actif. Les protéines et autres composants cellulaires sont activés dans les cellules musculaires. L’absorption des acides aminés et la synthèse des protéines sont toutes deux augmentées. L’IGF mobilise les graisses pour les utiliser comme énergie dans le tissu adipeux en tant que source de carburant.

  • Augmente la synthèse des protéines tout en fournissant des nutriments directement aux cellules et aux muscles pour un effet maximal.
  • Favorise la croissance musculaire tout en diminuant la graisse corporelle.
  • La graisse est mobilisée par l’IGF et utilisée comme énergie dans le tissu adipeux.
  • Il provoque également une hyperplasie, qui est une augmentation du nombre de cellules musculaires.
  • Il a le potentiel de modifier la capacité d’une personne à augmenter la densité et la taille des muscles.

Études:

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5750484/


Effets:

  • Réparation cellulaire accrue, régénération totale du corps (y compris les organes internes)
  • Inhiber le processus de vieillissement et de rajeunissement, ainsi que ralentir le processus de vieillissement
  • La production de collagène augmente, la peau devient plus saine et les rides sont réduites en conséquence.
  • Fort effet anabolisant/favorise la croissance, la force et la performance du tissu musculaire
  • Capacité d’induction d’hyperplasie musculaire
  • Fort effet anti-catabolique préservant les muscles
  • Un niveau élevé de teneur en minéraux ou de densité osseuse
  • Améliore les processus d’apprentissage et de mémoire dans le cerveau
  • Rajeunit le système nerveux et le cerveau.
  • Ce supplément a le potentiel de réduire votre risque de maladie cardiaque et vasculaire.
  • Des défenses améliorées contre les infections
  • Effets sur l’inflammation anti-inflammatoire
  • Amélioration de la santé intestinale

Effets secondaires:

Les études d’innocuité n’ont montré aucun effet indésirable associé à l’utilisation de l’IGF-1 LR3.

De plus en plus de médecins et de scientifiques étudient les avantages du peptide IGF-1 LR3 maintenant que l’innovation médicale est en hausse. Les chercheurs ont constaté des effets impressionnants de ce peptide jusqu’à présent et ils s’attendent à en découvrir davantage au fur et à mesure que la recherche se poursuit.


Formule : C400H625N111O115S9

Masse molaire:9.1k

Séquence : MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA

Quantité unitaire: 1Fiole

Aspect: poudre blanche

Pureté peptidique:> 99%

Informations complémentaires

Taille

01.mg, 1mg

Avis

Il n’y a pas encore d’avis.

Soyez le premier à laisser votre avis sur “IGF-1 LR3”

Votre adresse e-mail ne sera pas publiée. Les champs obligatoires sont indiqués avec *